{
  "$schema": "local://mst-1.0.0.json",
  "access": {
    "embargo": {
      "active": false,
      "reason": null
    },
    "files": "public",
    "record": "public",
    "status": "open"
  },
  "created": "2026-01-05T12:33:09.759711+00:00",
  "custom_fields": {},
  "deletion_status": {
    "is_deleted": false,
    "status": "P"
  },
  "expanded": {
    "parent": {
      "access": {
        "owned_by": {
          "active": null,
          "blocked_at": null,
          "confirmed_at": null,
          "email": "",
          "id": "51",
          "is_current_user": false,
          "links": {
            "avatar": "https://mbdb-data.org/api/users/51/avatar.svg",
            "records_html": "https://mbdb-data.org/search/records?q=parent.access.owned_by.user:51",
            "self": "https://mbdb-data.org/api/users/51"
          },
          "profile": {
            "affiliations": "Institute of Biotechnology of the Czech Academy of Sciences",
            "full_name": "Gustavo Fuertes"
          },
          "username": "gustavofuertes",
          "verified_at": null
        }
      }
    },
    "request_types": [],
    "requests": []
  },
  "files": {
    "enabled": true
  },
  "id": "p408m-6b985",
  "is_draft": false,
  "is_published": true,
  "links": {
    "access": "https://mbdb-data.org/api/records/p408m-6b985/access",
    "access_grants": "https://mbdb-data.org/api/records/p408m-6b985/access/grants",
    "access_groups": "https://mbdb-data.org/api/records/p408m-6b985/access/groups",
    "access_links": "https://mbdb-data.org/api/records/p408m-6b985/access/links",
    "access_request": "https://mbdb-data.org/api/records/p408m-6b985/access/request",
    "access_users": "https://mbdb-data.org/api/records/p408m-6b985/access/users",
    "applicable-requests": "https://mbdb-data.org/api/records/mst/p408m-6b985/requests/applicable",
    "archive": "https://mbdb-data.org/api/records/mst/p408m-6b985/files-archive",
    "archive_media": "https://mbdb-data.org/api/records/p408m-6b985/media-files-archive",
    "communities": {},
    "communities-suggestions": "https://mbdb-data.org/api/records/p408m-6b985/communities-suggestions",
    "doi": "https://doi.org/10.71479/p408m-6b985",
    "files": "https://mbdb-data.org/api/records/mst/p408m-6b985/files",
    "latest": "https://mbdb-data.org/api/records/mst/p408m-6b985/versions/latest",
    "latest_html": "https://mbdb-data.org/mst/p408m-6b985/latest",
    "media_files": "https://mbdb-data.org/api/records/p408m-6b985/media-files",
    "parent": "https://mbdb-data.org/api/records/4hetg-z6d83",
    "parent_html": "https://mbdb-data.org/records/4hetg-z6d83",
    "record": "https://mbdb-data.org/api/records/mst/p408m-6b985",
    "requests": "https://mbdb-data.org/api/records/mst/p408m-6b985/requests",
    "reserve_doi": "https://mbdb-data.org/api/records/p408m-6b985/draft/pids/doi",
    "self": "https://mbdb-data.org/api/records/mst/p408m-6b985",
    "self_doi": "https://mbdb-data.org/doi/10.71479/p408m-6b985",
    "self_html": "https://mbdb-data.org/mst/p408m-6b985",
    "self_iiif_manifest": "https://mbdb-data.org/api/iiif/record:p408m-6b985/manifest",
    "self_iiif_sequence": "https://mbdb-data.org/api/iiif/record:p408m-6b985/sequence/default",
    "versions": "https://mbdb-data.org/api/records/mst/p408m-6b985/versions"
  },
  "media_files": {
    "count": 0,
    "enabled": false,
    "entries": {},
    "order": [],
    "total_bytes": 0
  },
  "metadata": {
    "general_parameters": {
      "associated_publication": {
        "journal": "Biosensors and Bioelectronics",
        "pid": "41014988",
        "title": "Front-illuminated surface plasmon resonance biosensor for the study of light-responsive proteins and their interactions",
        "type": "Article"
      },
      "chemical_environments": [
        {
          "constituents": [
            {
              "basic_information": {
                "@v": "fcccf715-7755-4d04-8ab6-b08ab0e69fdf::1",
                "additional_identifiers": [
                  "cid:78165"
                ],
                "chemical_formula": "C6H13NO4S",
                "id": "inchikey:SXGZJKUKBWWHRA-UHFFFAOYSA-N",
                "molecular_weight": {
                  "unit": "g/mol",
                  "value": 195.24
                },
                "title": {
                  "en": "4-Morpholineethanesulfonic acid (MES acid)"
                }
              },
              "concentration": {
                "unit": "mM",
                "value": 50.0
              },
              "name": "2-(N-morpholino)ethanesulfonic acid",
              "type": "Chemical"
            },
            {
              "basic_information": {
                "@v": "73da2ba6-ea73-4f16-b924-ca5cd659d440::1",
                "additional_identifiers": [
                  "cid:5234"
                ],
                "chemical_formula": "ClNa",
                "id": "inchikey:FAPWRFPIFSIZLT-UHFFFAOYSA-M",
                "molecular_weight": {
                  "unit": "g/mol",
                  "value": 58.44
                },
                "title": {
                  "en": "Sodium Chloride"
                }
              },
              "concentration": {
                "unit": "mM",
                "value": 100.0
              },
              "name": "Sodium chloride",
              "type": "Chemical"
            },
            {
              "basic_information": {
                "@v": "a8e92fa5-e8ec-49d0-b637-3a5e3a36bb66::1",
                "chemical_formula": "(C3H6O.C2H4O)x",
                "id": "inchikey: OQNWUUGFAWNUME-UHFFFAOYSA-N",
                "molecular_weight": {
                  "unit": "g/mol",
                  "value": 164.2
                },
                "title": {
                  "en": "Pluronic F-127"
                }
              },
              "concentration": {
                "unit": "v/v %",
                "value": 0.05
              },
              "name": "Pluoronic F-127",
              "type": "Chemical"
            }
          ],
          "id": "dad8c5e7-1f5b-4284-a0c4-98444ed164b4",
          "name": "MES 50 mM NaCl 100 mM Pluronic F-127 0.05%",
          "ph": 6.8,
          "solvent": [
            {
              "basic_information": {
                "@v": "7dc20ce5-6d90-4593-9849-08a15fd8d90c::1",
                "additional_identifiers": [
                  "cid:962"
                ],
                "chemical_formula": "H2O",
                "id": "inchikey:XLYOFNOQVPJJNP-UHFFFAOYSA-N",
                "molecular_weight": {
                  "unit": "g/mol",
                  "value": 18.02
                },
                "title": {
                  "en": "Water"
                }
              },
              "concentration": {
                "unit": "M",
                "value": 55.5
              },
              "name": "Water",
              "type": "Chemical"
            }
          ]
        }
      ],
      "depositors": {
        "contributors": [
          {
            "affiliations": [
              {
                "@v": "d8b285c3-a25e-4c5f-aa7b-7a4309e28a0a::1",
                "city": "Prague",
                "country": "Czechia",
                "id": "ror:00wzqmx94",
                "title": {
                  "en": "Czech Academy of Sciences, Institute of Biotechnology"
                }
              }
            ],
            "family_name": "Pham",
            "given_name": "Phuong Ngoc",
            "identifiers": [
              "orcid:0000-0002-5447-3343"
            ]
          }
        ],
        "depositor": {
          "affiliations": [
            {
              "@v": "d8b285c3-a25e-4c5f-aa7b-7a4309e28a0a::1",
              "city": "Prague",
              "country": "Czechia",
              "id": "ror:00wzqmx94",
              "title": {
                "en": "Czech Academy of Sciences, Institute of Biotechnology"
              }
            }
          ],
          "family_name": "Fuertes",
          "given_name": "Gustavo",
          "identifiers": [
            "orcid:0000-0002-8564-8644"
          ]
        },
        "principal_contact": {
          "affiliations": [
            {
              "@v": "d8b285c3-a25e-4c5f-aa7b-7a4309e28a0a::1",
              "city": "Prague",
              "country": "Czechia",
              "id": "ror:00wzqmx94",
              "title": {
                "en": "Czech Academy of Sciences, Institute of Biotechnology"
              }
            }
          ],
          "family_name": "Fuertes",
          "given_name": "Gustavo",
          "identifiers": [
            "orcid:0000-0002-8564-8644"
          ]
        }
      },
      "entities_of_interest": [
        {
          "expression_organism": {
            "@v": "b0de7c2a-9400-4bb4-816a-7ca8dddf0cc8::1",
            "id": "taxid:469008",
            "rank": "STRAIN",
            "title": {
              "en": "Escherichia coli BL21(DE3)"
            }
          },
          "expression_source_type": "Recombinantly",
          "external_databases": [
            "uniprot:Q2NB98",
            "pdb:8a5s"
          ],
          "id": "e653f96e-0cd6-4c33-be29-256fdd464cac",
          "molecular_weight": {
            "unit": "g/mol",
            "value": 23157.0
          },
          "name": "EL222",
          "polymer_type": "polypeptide(L)",
          "quality_controls": {
            "identity": {
              "assessed": "Yes",
              "by_intact_mass": {
                "deviation_from_expected_mass": {
                  "unit": "g/mol",
                  "value": 1.0
                },
                "method": "Mass spectrometry"
              }
            }
          },
          "sequence": "GADDTRVEVQPPAQWVLDLIEASPIASVVSDPRLADNPLIAINQAFTDLTGYSEEECVGRNCRFLAGSGTEPWLTDKIRQGVREHKPVLVEILNYKKDGTPFRNAVLVAPIYDDDDELLYFLGSQVEVDDDQPNMGMARRERAAEMLKTLSPRQLEVTTLVASGLRNKEVAARLGLSEKTVKMHRGLVMEKLNLKTSADLVRIAVEAGIA",
          "source_organism": {
            "@v": "10cf420e-7736-4282-979d-6eb14e21cb51::1",
            "id": "taxid:39960",
            "rank": "SPECIES",
            "title": {
              "en": "Erythrobacter litoralis"
            }
          },
          "type": "Polymer",
          "variant": "Contains residues 17-225 from the parental sequence plus an addtional alanine at the C-terminus"
        },
        {
          "expression_source_type": "Synthetically",
          "id": "d9fc49ae-6226-40ae-b512-4edfcf4e59e3",
          "modifications": {
            "chemical": [
              {
                "position": "5'",
                "type": "Atto647N"
              }
            ]
          },
          "molecular_weight": {
            "unit": "g/mol",
            "value": 13843.0
          },
          "name": "dsDNA20",
          "polymer_type": "polydeoxyribonucleotide",
          "sequence": "TAG GTA GCC TTT AGT CCA TG",
          "type": "Polymer"
        }
      ],
      "funding_references": [
        {
          "@v": "e0dad937-8d8d-4628-9b39-bcc6aa210d94::1",
          "funder_name": "Czech Science Foundation (GACR)",
          "grant_id": "24-11819S",
          "id": "oa:cac42f3a-6fc5-4d58-8727-615d2084419a",
          "title": {
            "en": "Time-resolved vibrational spectroscopy of proteins assisted by genetically encoded non-canonical amino acids"
          }
        },
        {
          "@v": "02e1a648-fdf4-4518-af78-9eaebad0f408::1",
          "funder_name": "European Regional Development Fund",
          "grant_id": "CZ.02.01.01/00/23_015/0008175",
          "id": "oa:7c061965-092d-4282-a2c4-ad19673c3073",
          "title": {
            "en": "Innovation of Czech Infrastructure for Integrative Structural Biology"
          }
        },
        {
          "@v": "2e6bb2fe-89c3-48ce-8791-ad4f4df61ad0::1",
          "funder_name": "MEYS CR",
          "grant_id": " LM2023042",
          "id": "oa:5e0f5b4f-78cb-469b-91bb-d6705c76f163",
          "title": {
            "en": "CIISB, Instruct-CZ Centre of Instruct-ERIC EU consortium"
          }
        }
      ],
      "instrument": {
        "@v": "4b563b9f-97d1-4927-b2ad-67824980ff9a::1",
        "id": "ins:6",
        "manufacturer": "Nanotemper",
        "title": {
          "en": "Monolith NT.115 RED/GREEN"
        }
      },
      "method": "Microscale thermophoresis/Temperature related intensity change (MST/TRIC)",
      "record_information": {
        "access_rights": "open",
        "copyright": "Anyone is free to distribute the data and metadata",
        "date_available": "2026-01-05",
        "deposition_date": "2025-07-23",
        "external_identifier": "10.71479/p408m-6b985",
        "license": {
          "name": "CC0 1.0 Universal",
          "url": "https://creativecommons.org/publicdomain/zero/1.0/"
        },
        "publisher": "MBDB",
        "resource_type": "MST",
        "resource_type_general": "Dataset",
        "subject_category": "Biophysics",
        "title": "Interaction of EL222 with DNA (light 8-min delay)"
      },
      "results": [
        {
          "entities_involved": [
            {
              "copy_number": 2.0,
              "entity": {
                "id": "e653f96e-0cd6-4c33-be29-256fdd464cac",
                "name": "EL222"
              }
            },
            {
              "copy_number": 1.0,
              "entity": {
                "id": "d9fc49ae-6226-40ae-b512-4edfcf4e59e3",
                "name": "dsDNA20"
              }
            }
          ],
          "id": "c10dab87-8a06-4660-8d4e-a3da3e968909",
          "name": "EL222-DNA light 8-min delay",
          "type": "Half maximal effective concentration EC50",
          "unit": "\u00b5M",
          "value": 2.0,
          "value_error": {
            "is_relative": false,
            "lower": 0.2,
            "upper": 0.2
          }
        },
        {
          "entities_involved": [
            {
              "copy_number": 2.0,
              "entity": {
                "id": "e653f96e-0cd6-4c33-be29-256fdd464cac",
                "name": "EL222"
              }
            },
            {
              "copy_number": 1.0,
              "entity": {
                "id": "d9fc49ae-6226-40ae-b512-4edfcf4e59e3",
                "name": "dsDNA20"
              }
            }
          ],
          "id": "7deedf88-3209-41e9-9dda-507d817e1c5e",
          "name": "EL222-DNA light 8-min delay",
          "type": "Hill coefficient",
          "unit": "unitless",
          "value": 1.8
        }
      ],
      "schema_version": "0.15.0"
    },
    "method_specific_parameters": {
      "excitation_led_color": "RED (ex 605-645nm, em 660-720nm)",
      "excitation_led_power": 40.0,
      "experiment_type": "Affinity",
      "ir_mst_laser_power": 40.0,
      "measurements": [
        {
          "id": "4ea6be83-489e-4457-a94a-55f41267701e",
          "name": "EL222-DNA (rep 1)",
          "position": "1",
          "sample": {
            "chemical_environment": {
              "id": "dad8c5e7-1f5b-4284-a0c4-98444ed164b4",
              "name": "MES 50 mM NaCl 100 mM Pluronic F-127 0.05%"
            },
            "ligands": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 50000.0
                },
                "entity": {
                  "id": "e653f96e-0cd6-4c33-be29-256fdd464cac",
                  "name": "EL222"
                }
              }
            ],
            "measurement_container": "Monolith Premium Capillary",
            "preparation_protocol": [
              {
                "description": "An EL222 stock at 100 micromolar concentration was illuminated in a circular quartz cuvette ( 1mm pathlength) for 5 minutes with an LED emitting at a wavelength of 455 nm and an irradiance of 15 mW/cm2. The samples was subsequently diluted and mixded with dsDNA 20. The 8-minutes delays referes to the time between the end of the illumination and the start of actural MST experiment. This applies to all measurements in this record.",
                "name": "Illumination"
              }
            ],
            "targets": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 20.0
                },
                "entity": {
                  "id": "d9fc49ae-6226-40ae-b512-4edfcf4e59e3",
                  "name": "dsDNA20"
                }
              }
            ]
          }
        },
        {
          "id": "45f7a0f9-7afd-4b1a-b7e0-4f257a64ae23",
          "name": "EL222-DNA (rep 1)",
          "position": "2",
          "sample": {
            "chemical_environment": {
              "id": "dad8c5e7-1f5b-4284-a0c4-98444ed164b4",
              "name": "MES 50 mM NaCl 100 mM Pluronic F-127 0.05%"
            },
            "ligands": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 25000.0
                },
                "entity": {
                  "id": "e653f96e-0cd6-4c33-be29-256fdd464cac",
                  "name": "EL222"
                }
              }
            ],
            "measurement_container": "Monolith Premium Capillary",
            "targets": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 20.0
                },
                "entity": {
                  "id": "d9fc49ae-6226-40ae-b512-4edfcf4e59e3",
                  "name": "dsDNA20"
                }
              }
            ]
          }
        },
        {
          "id": "c7912ecf-1c95-4e4d-9c36-17896d7dbc67",
          "name": "EL222-DNA (rep 1)",
          "position": "3",
          "sample": {
            "chemical_environment": {
              "id": "dad8c5e7-1f5b-4284-a0c4-98444ed164b4",
              "name": "MES 50 mM NaCl 100 mM Pluronic F-127 0.05%"
            },
            "ligands": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 12500.0
                },
                "entity": {
                  "id": "e653f96e-0cd6-4c33-be29-256fdd464cac",
                  "name": "EL222"
                }
              }
            ],
            "measurement_container": "Monolith Premium Capillary",
            "targets": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 20.0
                },
                "entity": {
                  "id": "d9fc49ae-6226-40ae-b512-4edfcf4e59e3",
                  "name": "dsDNA20"
                }
              }
            ]
          }
        },
        {
          "id": "efc86613-3df2-483c-a65f-463901580673",
          "name": "EL222-DNA (rep 1)",
          "position": "4",
          "sample": {
            "chemical_environment": {
              "id": "dad8c5e7-1f5b-4284-a0c4-98444ed164b4",
              "name": "MES 50 mM NaCl 100 mM Pluronic F-127 0.05%"
            },
            "ligands": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 6250.0
                },
                "entity": {
                  "id": "e653f96e-0cd6-4c33-be29-256fdd464cac",
                  "name": "EL222"
                }
              }
            ],
            "measurement_container": "Monolith Premium Capillary",
            "targets": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 20.0
                },
                "entity": {
                  "id": "d9fc49ae-6226-40ae-b512-4edfcf4e59e3",
                  "name": "dsDNA20"
                }
              }
            ]
          }
        },
        {
          "id": "39d397f6-62bf-4089-805c-519cc5a53a87",
          "name": "EL222-DNA (rep 1)",
          "position": "5",
          "sample": {
            "chemical_environment": {
              "id": "dad8c5e7-1f5b-4284-a0c4-98444ed164b4",
              "name": "MES 50 mM NaCl 100 mM Pluronic F-127 0.05%"
            },
            "ligands": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 3125.0
                },
                "entity": {
                  "id": "e653f96e-0cd6-4c33-be29-256fdd464cac",
                  "name": "EL222"
                }
              }
            ],
            "measurement_container": "Monolith Premium Capillary",
            "targets": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 20.0
                },
                "entity": {
                  "id": "d9fc49ae-6226-40ae-b512-4edfcf4e59e3",
                  "name": "dsDNA20"
                }
              }
            ]
          }
        },
        {
          "id": "08b30b6d-72c1-4469-a304-a86e8355d985",
          "name": "EL222-DNA (rep 1)",
          "position": "6",
          "sample": {
            "chemical_environment": {
              "id": "dad8c5e7-1f5b-4284-a0c4-98444ed164b4",
              "name": "MES 50 mM NaCl 100 mM Pluronic F-127 0.05%"
            },
            "ligands": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 1562.5
                },
                "entity": {
                  "id": "e653f96e-0cd6-4c33-be29-256fdd464cac",
                  "name": "EL222"
                }
              }
            ],
            "measurement_container": "Monolith Premium Capillary",
            "targets": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 20.0
                },
                "entity": {
                  "id": "d9fc49ae-6226-40ae-b512-4edfcf4e59e3",
                  "name": "dsDNA20"
                }
              }
            ]
          }
        },
        {
          "id": "0e36ccb5-d239-4084-84b1-4b53bc1cad80",
          "name": "EL222-DNA (rep 1)",
          "position": "7",
          "sample": {
            "chemical_environment": {
              "id": "dad8c5e7-1f5b-4284-a0c4-98444ed164b4",
              "name": "MES 50 mM NaCl 100 mM Pluronic F-127 0.05%"
            },
            "ligands": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 781.3
                },
                "entity": {
                  "id": "e653f96e-0cd6-4c33-be29-256fdd464cac",
                  "name": "EL222"
                }
              }
            ],
            "measurement_container": "Monolith Premium Capillary",
            "targets": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 20.0
                },
                "entity": {
                  "id": "d9fc49ae-6226-40ae-b512-4edfcf4e59e3",
                  "name": "dsDNA20"
                }
              }
            ]
          }
        },
        {
          "id": "dbdf3829-9984-40ba-82a2-6817e079897f",
          "name": "EL222-DNA (rep 1)",
          "position": "8",
          "sample": {
            "chemical_environment": {
              "id": "dad8c5e7-1f5b-4284-a0c4-98444ed164b4",
              "name": "MES 50 mM NaCl 100 mM Pluronic F-127 0.05%"
            },
            "ligands": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 390.6
                },
                "entity": {
                  "id": "e653f96e-0cd6-4c33-be29-256fdd464cac",
                  "name": "EL222"
                }
              }
            ],
            "measurement_container": "Monolith Premium Capillary",
            "targets": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 20.0
                },
                "entity": {
                  "id": "d9fc49ae-6226-40ae-b512-4edfcf4e59e3",
                  "name": "dsDNA20"
                }
              }
            ]
          }
        },
        {
          "id": "a9e63aa3-3c2b-4bf9-8d4a-fe2c42cf3f3f",
          "name": "EL222-DNA (rep 1)",
          "position": "9",
          "sample": {
            "chemical_environment": {
              "id": "dad8c5e7-1f5b-4284-a0c4-98444ed164b4",
              "name": "MES 50 mM NaCl 100 mM Pluronic F-127 0.05%"
            },
            "ligands": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 195.3
                },
                "entity": {
                  "id": "e653f96e-0cd6-4c33-be29-256fdd464cac",
                  "name": "EL222"
                }
              }
            ],
            "measurement_container": "Monolith Premium Capillary",
            "targets": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 20.0
                },
                "entity": {
                  "id": "d9fc49ae-6226-40ae-b512-4edfcf4e59e3",
                  "name": "dsDNA20"
                }
              }
            ]
          }
        },
        {
          "id": "0de2f879-f549-4578-860e-755ba0958d75",
          "name": "EL222-DNA (rep 1)",
          "position": "10",
          "sample": {
            "chemical_environment": {
              "id": "dad8c5e7-1f5b-4284-a0c4-98444ed164b4",
              "name": "MES 50 mM NaCl 100 mM Pluronic F-127 0.05%"
            },
            "ligands": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 97.7
                },
                "entity": {
                  "id": "e653f96e-0cd6-4c33-be29-256fdd464cac",
                  "name": "EL222"
                }
              }
            ],
            "measurement_container": "Monolith Premium Capillary",
            "targets": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 20.0
                },
                "entity": {
                  "id": "d9fc49ae-6226-40ae-b512-4edfcf4e59e3",
                  "name": "dsDNA20"
                }
              }
            ]
          }
        },
        {
          "id": "23c9d982-a078-4977-a140-6a8c6ce94493",
          "name": "EL222-DNA (rep 1)",
          "position": "11",
          "sample": {
            "chemical_environment": {
              "id": "dad8c5e7-1f5b-4284-a0c4-98444ed164b4",
              "name": "MES 50 mM NaCl 100 mM Pluronic F-127 0.05%"
            },
            "ligands": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 48.8
                },
                "entity": {
                  "id": "e653f96e-0cd6-4c33-be29-256fdd464cac",
                  "name": "EL222"
                }
              }
            ],
            "measurement_container": "Monolith Premium Capillary",
            "targets": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 20.0
                },
                "entity": {
                  "id": "d9fc49ae-6226-40ae-b512-4edfcf4e59e3",
                  "name": "dsDNA20"
                }
              }
            ]
          }
        },
        {
          "id": "982a8e8a-fc8a-413f-a716-f592bf228312",
          "name": "EL222-DNA (rep 1)",
          "position": "12",
          "sample": {
            "chemical_environment": {
              "id": "dad8c5e7-1f5b-4284-a0c4-98444ed164b4",
              "name": "MES 50 mM NaCl 100 mM Pluronic F-127 0.05%"
            },
            "ligands": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 24.4
                },
                "entity": {
                  "id": "e653f96e-0cd6-4c33-be29-256fdd464cac",
                  "name": "EL222"
                }
              }
            ],
            "measurement_container": "Monolith Premium Capillary",
            "targets": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 20.0
                },
                "entity": {
                  "id": "d9fc49ae-6226-40ae-b512-4edfcf4e59e3",
                  "name": "dsDNA20"
                }
              }
            ]
          }
        },
        {
          "id": "3137a296-6ac0-497d-9c39-f37d85e229ab",
          "name": "EL222-DNA (rep 1)",
          "position": "13",
          "sample": {
            "chemical_environment": {
              "id": "dad8c5e7-1f5b-4284-a0c4-98444ed164b4",
              "name": "MES 50 mM NaCl 100 mM Pluronic F-127 0.05%"
            },
            "ligands": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 12.2
                },
                "entity": {
                  "id": "e653f96e-0cd6-4c33-be29-256fdd464cac",
                  "name": "EL222"
                }
              }
            ],
            "measurement_container": "Monolith Premium Capillary",
            "targets": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 20.0
                },
                "entity": {
                  "id": "d9fc49ae-6226-40ae-b512-4edfcf4e59e3",
                  "name": "dsDNA20"
                }
              }
            ]
          }
        },
        {
          "id": "ea7d8204-8f6d-4796-80a9-b4fecd8cf9ce",
          "name": "EL222-DNA (rep 1)",
          "position": "14",
          "sample": {
            "chemical_environment": {
              "id": "dad8c5e7-1f5b-4284-a0c4-98444ed164b4",
              "name": "MES 50 mM NaCl 100 mM Pluronic F-127 0.05%"
            },
            "ligands": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 6.1
                },
                "entity": {
                  "id": "e653f96e-0cd6-4c33-be29-256fdd464cac",
                  "name": "EL222"
                }
              }
            ],
            "measurement_container": "Monolith Premium Capillary",
            "targets": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 20.0
                },
                "entity": {
                  "id": "d9fc49ae-6226-40ae-b512-4edfcf4e59e3",
                  "name": "dsDNA20"
                }
              }
            ]
          }
        },
        {
          "id": "f002b2a3-2289-4245-a4f5-52e5b7b32322",
          "name": "EL222-DNA (rep 1)",
          "position": "15",
          "sample": {
            "chemical_environment": {
              "id": "dad8c5e7-1f5b-4284-a0c4-98444ed164b4",
              "name": "MES 50 mM NaCl 100 mM Pluronic F-127 0.05%"
            },
            "ligands": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 3.1
                },
                "entity": {
                  "id": "e653f96e-0cd6-4c33-be29-256fdd464cac",
                  "name": "EL222"
                }
              }
            ],
            "measurement_container": "Monolith Premium Capillary",
            "targets": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 20.0
                },
                "entity": {
                  "id": "d9fc49ae-6226-40ae-b512-4edfcf4e59e3",
                  "name": "dsDNA20"
                }
              }
            ]
          }
        },
        {
          "id": "60e15354-4bca-40c7-a1a3-7df10ba8860b",
          "name": "EL222-DNA (rep 1)",
          "position": "16",
          "sample": {
            "chemical_environment": {
              "id": "dad8c5e7-1f5b-4284-a0c4-98444ed164b4",
              "name": "MES 50 mM NaCl 100 mM Pluronic F-127 0.05%"
            },
            "ligands": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 1.5
                },
                "entity": {
                  "id": "e653f96e-0cd6-4c33-be29-256fdd464cac",
                  "name": "EL222"
                }
              }
            ],
            "measurement_container": "Monolith Premium Capillary",
            "targets": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 20.0
                },
                "entity": {
                  "id": "d9fc49ae-6226-40ae-b512-4edfcf4e59e3",
                  "name": "dsDNA20"
                }
              }
            ]
          }
        },
        {
          "id": "ad9fbf24-e12a-41c3-ad7d-17dd47fc9582",
          "name": "EL222-DNA (rep 2)",
          "position": "1",
          "sample": {
            "chemical_environment": {
              "id": "dad8c5e7-1f5b-4284-a0c4-98444ed164b4",
              "name": "MES 50 mM NaCl 100 mM Pluronic F-127 0.05%"
            },
            "ligands": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 50000.0
                },
                "entity": {
                  "id": "e653f96e-0cd6-4c33-be29-256fdd464cac",
                  "name": "EL222"
                }
              }
            ],
            "measurement_container": "Monolith Premium Capillary",
            "targets": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 20.0
                },
                "entity": {
                  "id": "d9fc49ae-6226-40ae-b512-4edfcf4e59e3",
                  "name": "dsDNA20"
                }
              }
            ]
          }
        },
        {
          "id": "7065a10e-a62b-4314-b976-9202377313f7",
          "name": "EL222-DNA (rep 2)",
          "position": "2",
          "sample": {
            "chemical_environment": {
              "id": "dad8c5e7-1f5b-4284-a0c4-98444ed164b4",
              "name": "MES 50 mM NaCl 100 mM Pluronic F-127 0.05%"
            },
            "ligands": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 25000.0
                },
                "entity": {
                  "id": "e653f96e-0cd6-4c33-be29-256fdd464cac",
                  "name": "EL222"
                }
              }
            ],
            "measurement_container": "Monolith Premium Capillary",
            "targets": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 20.0
                },
                "entity": {
                  "id": "d9fc49ae-6226-40ae-b512-4edfcf4e59e3",
                  "name": "dsDNA20"
                }
              }
            ]
          }
        },
        {
          "id": "03c9a8b6-b381-4d93-9553-948ffad6ed93",
          "name": "EL222-DNA (rep 2)",
          "position": "3",
          "sample": {
            "chemical_environment": {
              "id": "dad8c5e7-1f5b-4284-a0c4-98444ed164b4",
              "name": "MES 50 mM NaCl 100 mM Pluronic F-127 0.05%"
            },
            "ligands": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 12500.0
                },
                "entity": {
                  "id": "e653f96e-0cd6-4c33-be29-256fdd464cac",
                  "name": "EL222"
                }
              }
            ],
            "measurement_container": "Monolith Premium Capillary",
            "targets": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 20.0
                },
                "entity": {
                  "id": "d9fc49ae-6226-40ae-b512-4edfcf4e59e3",
                  "name": "dsDNA20"
                }
              }
            ]
          }
        },
        {
          "id": "de49c25e-c8b7-4802-afc6-b92a1723f907",
          "name": "EL222-DNA (rep 2)",
          "position": "4",
          "sample": {
            "chemical_environment": {
              "id": "dad8c5e7-1f5b-4284-a0c4-98444ed164b4",
              "name": "MES 50 mM NaCl 100 mM Pluronic F-127 0.05%"
            },
            "ligands": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 6250.0
                },
                "entity": {
                  "id": "e653f96e-0cd6-4c33-be29-256fdd464cac",
                  "name": "EL222"
                }
              }
            ],
            "measurement_container": "Monolith Premium Capillary",
            "targets": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 20.0
                },
                "entity": {
                  "id": "d9fc49ae-6226-40ae-b512-4edfcf4e59e3",
                  "name": "dsDNA20"
                }
              }
            ]
          }
        },
        {
          "id": "acb75d7a-7426-4e9b-a57b-b7c29dc7febb",
          "name": "EL222-DNA (rep 2)",
          "position": "5",
          "sample": {
            "chemical_environment": {
              "id": "dad8c5e7-1f5b-4284-a0c4-98444ed164b4",
              "name": "MES 50 mM NaCl 100 mM Pluronic F-127 0.05%"
            },
            "ligands": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 3125.0
                },
                "entity": {
                  "id": "e653f96e-0cd6-4c33-be29-256fdd464cac",
                  "name": "EL222"
                }
              }
            ],
            "measurement_container": "Monolith Premium Capillary",
            "targets": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 20.0
                },
                "entity": {
                  "id": "d9fc49ae-6226-40ae-b512-4edfcf4e59e3",
                  "name": "dsDNA20"
                }
              }
            ]
          }
        },
        {
          "id": "b5dc8bd4-c8d4-4e2d-acce-7c6d347755fc",
          "name": "EL222-DNA (rep 2)",
          "position": "6",
          "sample": {
            "chemical_environment": {
              "id": "dad8c5e7-1f5b-4284-a0c4-98444ed164b4",
              "name": "MES 50 mM NaCl 100 mM Pluronic F-127 0.05%"
            },
            "ligands": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 1562.5
                },
                "entity": {
                  "id": "e653f96e-0cd6-4c33-be29-256fdd464cac",
                  "name": "EL222"
                }
              }
            ],
            "measurement_container": "Monolith Premium Capillary",
            "targets": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 20.0
                },
                "entity": {
                  "id": "d9fc49ae-6226-40ae-b512-4edfcf4e59e3",
                  "name": "dsDNA20"
                }
              }
            ]
          }
        },
        {
          "id": "2d3f83af-c903-4eb0-b4c8-5ab131dfe252",
          "name": "EL222-DNA (rep 2)",
          "position": "7",
          "sample": {
            "chemical_environment": {
              "id": "dad8c5e7-1f5b-4284-a0c4-98444ed164b4",
              "name": "MES 50 mM NaCl 100 mM Pluronic F-127 0.05%"
            },
            "ligands": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 781.3
                },
                "entity": {
                  "id": "e653f96e-0cd6-4c33-be29-256fdd464cac",
                  "name": "EL222"
                }
              }
            ],
            "measurement_container": "Monolith Premium Capillary",
            "targets": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 20.0
                },
                "entity": {
                  "id": "d9fc49ae-6226-40ae-b512-4edfcf4e59e3",
                  "name": "dsDNA20"
                }
              }
            ]
          }
        },
        {
          "id": "b5995a20-bde5-432b-a6e9-58e902b988c7",
          "name": "EL222-DNA (rep 2)",
          "position": "8",
          "sample": {
            "chemical_environment": {
              "id": "dad8c5e7-1f5b-4284-a0c4-98444ed164b4",
              "name": "MES 50 mM NaCl 100 mM Pluronic F-127 0.05%"
            },
            "ligands": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 390.6
                },
                "entity": {
                  "id": "e653f96e-0cd6-4c33-be29-256fdd464cac",
                  "name": "EL222"
                }
              }
            ],
            "measurement_container": "Monolith Premium Capillary",
            "targets": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 20.0
                },
                "entity": {
                  "id": "d9fc49ae-6226-40ae-b512-4edfcf4e59e3",
                  "name": "dsDNA20"
                }
              }
            ]
          }
        },
        {
          "id": "7c1013f6-b0d1-4da2-be3d-d2977df56ee7",
          "name": "EL222-DNA (rep 2)",
          "position": "9",
          "sample": {
            "chemical_environment": {
              "id": "dad8c5e7-1f5b-4284-a0c4-98444ed164b4",
              "name": "MES 50 mM NaCl 100 mM Pluronic F-127 0.05%"
            },
            "ligands": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 195.3
                },
                "entity": {
                  "id": "e653f96e-0cd6-4c33-be29-256fdd464cac",
                  "name": "EL222"
                }
              }
            ],
            "measurement_container": "Monolith Premium Capillary",
            "targets": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 20.0
                },
                "entity": {
                  "id": "d9fc49ae-6226-40ae-b512-4edfcf4e59e3",
                  "name": "dsDNA20"
                }
              }
            ]
          }
        },
        {
          "id": "7198643a-34d9-4663-8fc3-f8ffa2edef8b",
          "name": "EL222-DNA (rep 2)",
          "position": "10",
          "sample": {
            "chemical_environment": {
              "id": "dad8c5e7-1f5b-4284-a0c4-98444ed164b4",
              "name": "MES 50 mM NaCl 100 mM Pluronic F-127 0.05%"
            },
            "ligands": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 97.7
                },
                "entity": {
                  "id": "e653f96e-0cd6-4c33-be29-256fdd464cac",
                  "name": "EL222"
                }
              }
            ],
            "measurement_container": "Monolith Premium Capillary",
            "targets": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 20.0
                },
                "entity": {
                  "id": "d9fc49ae-6226-40ae-b512-4edfcf4e59e3",
                  "name": "dsDNA20"
                }
              }
            ]
          }
        },
        {
          "id": "744fbc8c-eaa7-413c-8679-7a7f49f20085",
          "name": "EL222-DNA (rep 2)",
          "position": "11",
          "sample": {
            "chemical_environment": {
              "id": "dad8c5e7-1f5b-4284-a0c4-98444ed164b4",
              "name": "MES 50 mM NaCl 100 mM Pluronic F-127 0.05%"
            },
            "ligands": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 48.8
                },
                "entity": {
                  "id": "e653f96e-0cd6-4c33-be29-256fdd464cac",
                  "name": "EL222"
                }
              }
            ],
            "measurement_container": "Monolith Premium Capillary",
            "targets": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 20.0
                },
                "entity": {
                  "id": "d9fc49ae-6226-40ae-b512-4edfcf4e59e3",
                  "name": "dsDNA20"
                }
              }
            ]
          }
        },
        {
          "id": "005e1621-3767-460f-9cf0-1e6d3a8781f7",
          "name": "EL222-DNA (rep 2)",
          "position": "12",
          "sample": {
            "chemical_environment": {
              "id": "dad8c5e7-1f5b-4284-a0c4-98444ed164b4",
              "name": "MES 50 mM NaCl 100 mM Pluronic F-127 0.05%"
            },
            "ligands": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 24.4
                },
                "entity": {
                  "id": "e653f96e-0cd6-4c33-be29-256fdd464cac",
                  "name": "EL222"
                }
              }
            ],
            "measurement_container": "Monolith Premium Capillary",
            "targets": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 20.0
                },
                "entity": {
                  "id": "d9fc49ae-6226-40ae-b512-4edfcf4e59e3",
                  "name": "dsDNA20"
                }
              }
            ]
          }
        },
        {
          "id": "69247fbb-0803-4f50-9c1e-4b3d877a7a7d",
          "name": "EL222-DNA (rep 2)",
          "position": "13",
          "sample": {
            "chemical_environment": {
              "id": "dad8c5e7-1f5b-4284-a0c4-98444ed164b4",
              "name": "MES 50 mM NaCl 100 mM Pluronic F-127 0.05%"
            },
            "ligands": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 12.2
                },
                "entity": {
                  "id": "e653f96e-0cd6-4c33-be29-256fdd464cac",
                  "name": "EL222"
                }
              }
            ],
            "measurement_container": "Monolith Premium Capillary",
            "targets": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 20.0
                },
                "entity": {
                  "id": "d9fc49ae-6226-40ae-b512-4edfcf4e59e3",
                  "name": "dsDNA20"
                }
              }
            ]
          }
        },
        {
          "id": "dfb6df17-8e9f-4953-9a5d-94389f333722",
          "name": "EL222-DNA (rep 2)",
          "position": "14",
          "sample": {
            "chemical_environment": {
              "id": "dad8c5e7-1f5b-4284-a0c4-98444ed164b4",
              "name": "MES 50 mM NaCl 100 mM Pluronic F-127 0.05%"
            },
            "ligands": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 6.1
                },
                "entity": {
                  "id": "e653f96e-0cd6-4c33-be29-256fdd464cac",
                  "name": "EL222"
                }
              }
            ],
            "measurement_container": "Monolith Premium Capillary",
            "targets": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 20.0
                },
                "entity": {
                  "id": "d9fc49ae-6226-40ae-b512-4edfcf4e59e3",
                  "name": "dsDNA20"
                }
              }
            ]
          }
        },
        {
          "id": "80da31bf-873a-4bdb-9fab-82c8be45b07c",
          "name": "EL222-DNA (rep 2)",
          "position": "15",
          "sample": {
            "chemical_environment": {
              "id": "dad8c5e7-1f5b-4284-a0c4-98444ed164b4",
              "name": "MES 50 mM NaCl 100 mM Pluronic F-127 0.05%"
            },
            "ligands": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 3.1
                },
                "entity": {
                  "id": "e653f96e-0cd6-4c33-be29-256fdd464cac",
                  "name": "EL222"
                }
              }
            ],
            "measurement_container": "Monolith Premium Capillary",
            "targets": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 20.0
                },
                "entity": {
                  "id": "d9fc49ae-6226-40ae-b512-4edfcf4e59e3",
                  "name": "dsDNA20"
                }
              }
            ]
          }
        },
        {
          "id": "fbbce861-1ce3-413f-ab13-1a3d954060cb",
          "name": "EL222-DNA (rep 2)",
          "position": "16",
          "sample": {
            "chemical_environment": {
              "id": "dad8c5e7-1f5b-4284-a0c4-98444ed164b4",
              "name": "MES 50 mM NaCl 100 mM Pluronic F-127 0.05%"
            },
            "ligands": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 1.5
                },
                "entity": {
                  "id": "e653f96e-0cd6-4c33-be29-256fdd464cac",
                  "name": "EL222"
                }
              }
            ],
            "measurement_container": "Monolith Premium Capillary",
            "targets": [
              {
                "concentration": {
                  "unit": "nM",
                  "value": 20.0
                },
                "entity": {
                  "id": "d9fc49ae-6226-40ae-b512-4edfcf4e59e3",
                  "name": "dsDNA20"
                }
              }
            ]
          }
        }
      ],
      "schema_version": "0.9.12",
      "signal_type": "TRIC/MST",
      "temperature": {
        "unit": "\u00b0C",
        "value": 24.0
      }
    }
  },
  "parent": {
    "access": {
      "grants": [],
      "links": [],
      "owned_by": {
        "user": "51"
      },
      "settings": {
        "accept_conditions_text": null,
        "allow_guest_requests": true,
        "allow_user_requests": true,
        "secret_link_expiration": 0
      }
    },
    "communities": {},
    "id": "4hetg-z6d83",
    "is_verified": false,
    "pids": null,
    "workflow": "individual"
  },
  "pids": {
    "doi": {
      "identifier": "10.71479/p408m-6b985",
      "provider": "datacite"
    }
  },
  "revision_id": 4,
  "state": "published",
  "state_timestamp": "2026-01-05T12:33:09.761875+00:00",
  "stats": {
    "all_versions": {
      "data_volume": 0.0,
      "downloads": 0,
      "unique_downloads": 0,
      "unique_views": 0,
      "views": 0
    },
    "this_version": {
      "data_volume": 0.0,
      "downloads": 0,
      "unique_downloads": 0,
      "unique_views": 0,
      "views": 0
    }
  },
  "status": "published",
  "updated": "2026-01-05T12:33:12.289497+00:00",
  "versions": {
    "index": 1,
    "is_latest": true,
    "is_latest_draft": true
  }
}